Description
Anti-β-Actin, goat polyclonal antibody.
Anti-β-Actin
340,00 €
Anti-β-Actin, goat polyclonal antibody.
Catalogue No.: HBT019-200
Unit size: 200 µl
PRODUCT DATASHEET
Additional information
| Catalogue No.: | HBT019-200 |
|---|---|
| Description: | Anti-β-Actin, goat polyclonal antibody, Actin proteins are present in all eukaryotic cells and are highly conserved, They are ubiquitous and serve as the principal constituents of the cytoskeleton, playing a crucial role in a variety of cell movements. |
| Unit size: | 200 μL |
| Concentration: | 3 mg/mL |
| Host: | Goat (Capra hircus) |
| Isotype: | IgG |
| Clonality | Polyclonal |
| Purity: | Affinity purified from goat antiserum using the immunogen immobilized on a solid support. |
| Immunogen: | Imunogen sequence: MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE, Purified recombinant peptide derived from within residues 100 aa to the N-terminus of human β-Actin produced in E. coli |
| Specificity: | Detects a band (~42 kDa) in WB, in the following human (293A, primary fibroblasts, HaCat, HeLa, HMEC-1, Jurkat, MNT1, U-118, rat (TR-iBRB), monkey (COS-7) and canine (D17) whole cell lysates., mouse (3T3, AtT-20, Hepa, Raw264.7) |
| Applications: | WB: 1:250 – 1:2,000 | IF: 1:50 – 1:250 | IHC (F) 1:250 – 1:1,000 | IHC (P) 1:250 – 1:1,000 |
| Form: | Liquid. PBS pH7.4, 20% Glycerol and 0.05% sodium azide. |
| Storage: | For continuous use, store at 2-8°C for one-two days; for extended storage, store in -20 C freezer, Working dilution samples should be discarded if not used within 12 hours. |
